PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_004392-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 225aa    MW: 25450.7 Da    PI: 6.2552
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_004392-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.95.4e-19552148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l+d++k +G+g+W+++a++ g++R++k+c++rw +yl
    NNU_004392-RA  5 KGFWTVEEDKILIDYIKVHGKGRWNRVAKMTGLKRCGKSCRLRWMNYL 52
                     688*******************************************97 PP

2Myb_DNA-binding62.87e-2058103148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T+eEd+l+++++k+lG++ W++Ia +++ gRt++q+k++w+++l
    NNU_004392-RA  58 RGEFTEEEDDLIIRLHKLLGNR-WSLIAGRVP-GRTDNQVKNHWNTHL 103
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.438152IPR017930Myb domain
SuperFamilySSF466895.39E-32399IPR009057Homeodomain-like
SMARTSM007172.0E-16454IPR001005SANT/Myb domain
PfamPF002497.6E-17652IPR001005SANT/Myb domain
CDDcd001679.95E-13852No hitNo description
Gene3DG3DSA:1.10.10.601.2E-24859IPR009057Homeodomain-like
PROSITE profilePS5129430.17753107IPR017930Myb domain
SMARTSM007176.9E-1957105IPR001005SANT/Myb domain
PfamPF002492.4E-1858103IPR001005SANT/Myb domain
CDDcd001671.31E-1360103No hitNo description
Gene3DG3DSA:1.10.10.606.7E-2860107IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010053Biological Processroot epidermal cell differentiation
GO:0010091Biological Processtrichome branching
GO:0048629Biological Processtrichome patterning
GO:0090377Biological Processseed trichome initiation
GO:0090378Biological Processseed trichome elongation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MEEKKGFWTV EEDKILIDYI KVHGKGRWNR VAKMTGLKRC GKSCRLRWMN YLRPDVKRGE  60
FTEEEDDLII RLHKLLGNRW SLIAGRVPGR TDNQVKNHWN THLSKKLGIR KEKNKVVDVS  120
SSLTLFEKGN VEAGESLHLS THTNLSNLPI CDEDNSKAVG SAVNNIEASA SGNSLEALDL  180
ETQDPAMSEC YENSFWSLSD DLDINTPSLI EIPDGNSLDV VWRGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-30510727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00538DAPTransfer from AT5G40330Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010251260.11e-165PREDICTED: transcription factor WER-like
SwissprotQ962765e-69MYB23_ARATH; Transcription factor MYB23
TrEMBLA5BI142e-81A5BI14_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g08480.t015e-81(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.13e-70myb domain protein 23